Lineage for d5utja_ (5utj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840113Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 2840114Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 2840125Protein Queosine tRNA-guanine transglycosylase [51715] (3 species)
    contains zinc-binding subdomain
  7. 2840154Species Zymomonas mobilis [TaxId:542] [51716] (156 PDB entries)
    Uniprot P28720
  8. 2840256Domain d5utja_: 5utj A: [347704]
    automated match to d5lpta_
    protein/RNA complex; complexed with aza, dms, peg, zn

Details for d5utja_

PDB Entry: 5utj (more details), 1.55 Å

PDB Description: crystal structure of tgt in complex with 2,6-dioxy-8-azapurine, 2,6- dioxy-8-azapurine, 2,6-dioxy-8-azapurine
PDB Compounds: (A:) Queuine tRNA-ribosyltransferase

SCOPe Domain Sequences for d5utja_:

Sequence, based on SEQRES records: (download)

>d5utja_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilg
ntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshld
gsrhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsr
keqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvp
mlpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfse
dlkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegr
fsqfaqdfraryfa

Sequence, based on observed residues (ATOM records): (download)

>d5utja_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
drprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilg
ntyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmtkqseegvtfksrhmlsper
sieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeqaenaalf
giqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpmlpddkphyl
mgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkpldsech
cavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsqfaqdfra
ryfa

SCOPe Domain Coordinates for d5utja_:

Click to download the PDB-style file with coordinates for d5utja_.
(The format of our PDB-style files is described here.)

Timeline for d5utja_: