Lineage for d5n56b1 (5n56 B:2-91)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690578Species Staphylococcus aureus [TaxId:273036] [347666] (1 PDB entry)
  8. 2690580Domain d5n56b1: 5n56 B:2-91 [347702]
    Other proteins in same PDB: d5n56a2, d5n56b2
    automated match to d2rcva1
    complexed with mn

Details for d5n56b1

PDB Entry: 5n56 (more details), 2.07 Å

PDB Description: staphylococcus aureus mn-dependent superoxide dismutase soda
PDB Compounds: (B:) Superoxide dismutase [Mn/Fe] 1

SCOPe Domain Sequences for d5n56b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n56b1 a.2.11.0 (B:2-91) automated matches {Staphylococcus aureus [TaxId: 273036]}
afelpklpyafdalephfdketmeihhdrhhntyvtklnaavegtdlesksieeivanld
svpaniqtavrnnggghlnhslfwellspn

SCOPe Domain Coordinates for d5n56b1:

Click to download the PDB-style file with coordinates for d5n56b1.
(The format of our PDB-style files is described here.)

Timeline for d5n56b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5n56b2