SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1lpna_ (1lpn A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135098Family c.69.1.17: Fungal lipases [53558] (5 protein domains)
  6. 2135196Protein Type-B carboxylesterase/lipase [53566] (4 species)
  7. 2135207Species Fungus (Candida rugosa), formerly Cylindracea [TaxId:5481] [53568] (7 PDB entries)
  8. 2135214Domain d1lpna_: 1lpn A: [34770]
    complexed with ca, dsc, nag

Details for d1lpna_

PDB Entry: 1lpn (more details), 2.18 Å

PDB Description: analogs of reaction intermediates identify a unique substrate binding site in candida rugosa lipase
PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d1lpna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpna_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Candida rugosa), formerly Cylindracea [TaxId: 5481]}
aptatlangdtitglnaiineaflgipfaeppvgnlrfkdpvpysgsldgqkftsygpsc
mqqnpegtyeenlpkaaldlvmqskvfeavspssedcltinvvrppgtkaganlpvmlwi
fgggfevggtstfppaqmitksiamgkpiihvsvnyrvsswgflagdeikaegsanaglk
dqrlgmqwvadniaafggdptkvtifgesagsmsvmchilwndgdntykgkplfragimq
sgamvpsdavdgiygneifdllasnagcgsasdklaclrgvssdtledatnntpgflays
slrlsylprpdgvnitddmyalvregkyanipviigdqndegtffgtsslnvttdaqare
yfkqsfvhasdaeidtlmtaypgditqgspfdtgilnaltpqfkrisavlgdlgftlarr
yflnhytggtkysflskqlsglpvlgtfhsndivfqdyllgsgsliynnafiafatdldp
ntagllvkwpeytsssqsgnnlmminalglytgkdnfrtagydalfsnppsffv

SCOPe Domain Coordinates for d1lpna_:

Click to download the PDB-style file with coordinates for d1lpna_.
(The format of our PDB-style files is described here.)

Timeline for d1lpna_: