Lineage for d1lpna_ (1lpn A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135098Family c.69.1.17: Fungal lipases [53558] (5 protein domains)
  6. 2135196Protein Type-B carboxylesterase/lipase [53566] (4 species)
  7. 2135207Species Fungus (Candida rugosa), formerly Cylindracea [TaxId:5481] [53568] (7 PDB entries)
  8. 2135214Domain d1lpna_: 1lpn A: [34770]
    complexed with ca, dsc, nag

Details for d1lpna_

PDB Entry: 1lpn (more details), 2.18 Å

PDB Description: analogs of reaction intermediates identify a unique substrate binding site in candida rugosa lipase
PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d1lpna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpna_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Candida rugosa), formerly Cylindracea [TaxId: 5481]}
aptatlangdtitglnaiineaflgipfaeppvgnlrfkdpvpysgsldgqkftsygpsc
mqqnpegtyeenlpkaaldlvmqskvfeavspssedcltinvvrppgtkaganlpvmlwi
fgggfevggtstfppaqmitksiamgkpiihvsvnyrvsswgflagdeikaegsanaglk
dqrlgmqwvadniaafggdptkvtifgesagsmsvmchilwndgdntykgkplfragimq
sgamvpsdavdgiygneifdllasnagcgsasdklaclrgvssdtledatnntpgflays
slrlsylprpdgvnitddmyalvregkyanipviigdqndegtffgtsslnvttdaqare
yfkqsfvhasdaeidtlmtaypgditqgspfdtgilnaltpqfkrisavlgdlgftlarr
yflnhytggtkysflskqlsglpvlgtfhsndivfqdyllgsgsliynnafiafatdldp
ntagllvkwpeytsssqsgnnlmminalglytgkdnfrtagydalfsnppsffv

SCOPe Domain Coordinates for d1lpna_:

Click to download the PDB-style file with coordinates for d1lpna_.
(The format of our PDB-style files is described here.)

Timeline for d1lpna_: