| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.22: ASF1-like [101546] (2 families) ![]() contains extra C-terminal strand automatically mapped to Pfam PF04729 |
| Family b.1.22.1: ASF1-like [101547] (2 proteins) |
| Protein automated matches [195145] (3 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [347659] (6 PDB entries) |
| Domain d5ueax_: 5uea X: [347697] Other proteins in same PDB: d5ueaa_, d5ueab1, d5ueab2, d5ueah_, d5ueal1, d5ueal2 automated match to d2dzea_ |
PDB Entry: 5uea (more details), 1.7 Å
SCOPe Domain Sequences for d5ueax_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ueax_ b.1.22.1 (X:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsil
vgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeee
lrenppakvqvdhivrnilaekprvtrfnivwd
Timeline for d5ueax_: