SCOPe 2.07: Domain d5u3dc1: 5u3d C:4-54

Lineage for d5u3dc1 (5u3d C:4-54)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families)

5. Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
   automatically mapped to Pfam PF02216

6. Protein automated matches [191290] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [189943] (19 PDB entries)

8. Domain d5u3dc1: 5u3d C:4-54 [347693]
   Other proteins in same PDB: d5u3da1, d5u3da2, d5u3dc2, d5u3de1, d5u3de2
   automated match to d3qwoc_
   complexed with mry

Details for d5u3dc1

PDB Entry: 5u3d, 1.77 Å

PDB Description: structure of meditope enabled trastuzumab i83e variant

PDB Compounds: (C:) immunoglobulin g binding protein a

SCOPe Domain Sequences for d5u3dc1:

Sequence; same for both SEQRES and ATOM records:

>d5u3dc1 a.8.1.1 (C:4-54) automated matches {Staphylococcus aureus [TaxId: 1280]}
nkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqa

Timeline for d5u3dc1:

• d5u3dc1 is new in SCOPe 2.07-stable
  
• d5u3dc1 appears in the current release, SCOPe 2.08