Lineage for d1lpm__ (1lpm -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26848Family c.69.1.17: Fungal lipases [53558] (2 proteins)
  6. 26893Protein Type-B carboxylesterase/lipase [53566] (3 species)
  7. 26897Species Fungus (Candida rugosa), formerly Cylindracea [TaxId:5481] [53568] (7 PDB entries)
  8. 26902Domain d1lpm__: 1lpm - [34769]

Details for d1lpm__

PDB Entry: 1lpm (more details), 2.2 Å

PDB Description: a structural basis for the chiral preferences of lipases

SCOP Domain Sequences for d1lpm__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpm__ c.69.1.17 (-) Type-B carboxylesterase/lipase {Fungus (Candida rugosa), formerly Cylindracea}
aptatlangdtitglnaiineaflgipfaeppvgnlrfkdpvpysgsldgqkftsygpsc
mqqnpegtyeenlpkaaldlvmqskvfeavspssedcltinvvrppgtkaganlpvmlwi
fgggfevggtstfppaqmitksiamgkpiihvsvnyrvsswgflagdeikaegsanaglk
dqrlgmqwvadniaafggdptkvtifgesagsmsvmchilwndgdntykgkplfragimq
sgamvpsdavdgiygneifdllasnagcgsasdklaclrgvssdtledatnntpgflays
slrlsylprpdgvnitddmyalvregkyanipviigdqndegtffgtsslnvttdaqare
yfkqsfvhasdaeidtlmtaypgditqgspfdtgilnaltpqfkrisavlgdlgftlarr
yflnhytggtkysflskqlsglpvlgtfhsndivfqdyllgsgsliynnafiafatdldp
ntagllvkwpeytsssqsgnnlmminalglytgkdnfrtagydalfsnppsffv

SCOP Domain Coordinates for d1lpm__:

Click to download the PDB-style file with coordinates for d1lpm__.
(The format of our PDB-style files is described here.)

Timeline for d1lpm__: