Lineage for d5ud6b_ (5ud6 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836239Species Cyanidioschyzon merolae [TaxId:280699] [347621] (1 PDB entry)
  8. 2836241Domain d5ud6b_: 5ud6 B: [347688]
    automated match to d4i7ua_
    complexed with ca, lys

Details for d5ud6b_

PDB Entry: 5ud6 (more details), 2.4 Å

PDB Description: crystal structure of dhdps from cyanidioschyzon merolae with lysine bound
PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d5ud6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ud6b_ c.1.10.0 (B:) automated matches {Cyanidioschyzon merolae [TaxId: 280699]}
khffgrvitalvtpfkltgvevdygvaeslaahlaengsdaiivagttgesatltwseey
elfrvvksavagtkcrviagagsnsteeaieatkksaklgldgtlqvvpyynkppqqgim
ahfraianaapdlpmmlynipgrtginmtaetsiklaemcpnivalxeasgnleqfarir
ratspdfalysgddaltlpllslggngvvsvashfigpeiqrmiehfvdlgnpeeafrih
crymdlfealfvmanpipakaalrllgwpvgptrlpltditasaeqqlrqamiaagll

SCOPe Domain Coordinates for d5ud6b_:

Click to download the PDB-style file with coordinates for d5ud6b_.
(The format of our PDB-style files is described here.)

Timeline for d5ud6b_: