| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) ![]() |
| Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein) Pfam PF00552, Pfam PF18103 |
| Protein DNA-binding domain of retroviral integrase [50124] (4 species) |
| Species Human immunodeficiency virus type 1 [TaxId:11676] [50125] (8 PDB entries) |
| Domain d5tc2b_: 5tc2 B: [347682] automated match to d1c6vx_ complexed with gol |
PDB Entry: 5tc2 (more details), 1.84 Å
SCOPe Domain Sequences for d5tc2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tc2b_ b.34.7.1 (B:) DNA-binding domain of retroviral integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
kiqnfrvyyrdsrnslwkgpakllwkgegavviqdnsdikvvprrkakiirdygk
Timeline for d5tc2b_: