SCOPe 2.07: Domain d5n56a2: 5n56 A:92-199

Lineage for d5n56a2 (5n56 A:92-199)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (37 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:273036] [347668] (1 PDB entry)

8. Domain d5n56a2: 5n56 A:92-199 [347669]
   Other proteins in same PDB: d5n56a1, d5n56b1
   automated match to d2rcva2
   complexed with mn

Details for d5n56a2

PDB Entry: 5n56, 2.07 Å

PDB Description: staphylococcus aureus mn-dependent superoxide dismutase soda

PDB Compounds: (A:) Superoxide dismutase [Mn/Fe] 1

SCOPe Domain Sequences for d5n56a2:

Sequence; same for both SEQRES and ATOM records:

>d5n56a2 d.44.1.0 (A:92-199) automated matches {Staphylococcus aureus [TaxId: 273036]}
seekgtvvekikeqwgsleefkkefadkaaarfgsgwawlvvnngqleivttpnqdnplt
egktpilgldvwehayylkyqnkrpdyigafwnvvnwekvdelynatk

Timeline for d5n56a2:

• d5n56a2 is new in SCOPe 2.07-stable
  
• d5n56a2 appears in the current release, SCOPe 2.08