Class a: All alpha proteins [46456] (290 folds) |
Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.103.1: Citrate synthase [48256] (2 families) |
Family a.103.1.0: automated matches [191476] (1 protein) not a true family |
Protein automated matches [190763] (13 species) not a true protein |
Species Neosartorya fumigata [TaxId:746128] [347633] (5 PDB entries) |
Domain d5uqrb_: 5uqr B: [347661] Other proteins in same PDB: d5uqra2 automated match to d3enja_ complexed with 8jd, na, oaa |
PDB Entry: 5uqr (more details), 1.75 Å
SCOPe Domain Sequences for d5uqrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uqrb_ a.103.1.0 (B:) automated matches {Neosartorya fumigata [TaxId: 746128]} aepdlktalkavipakrelfkqvkersdevigevkvanviggmrglksmlwegsvldpee girfhgktikdcqkelpkgtsgtemlpeamfwllltgqvpstnqvrafsrelaeqshlpq hildliksfprsmhpmtqlsiavaalnteskfakayekglskadyweptfddsisllaki prvaalvfrpdevdqvgtqaldasqdwsynfaellgkggkenqdfhdllrlylalhgdhe ggnvsahathlvgsalsdpflsysagllglagplhglaaqevlrwilamqdkigtkftdd dvrnylwdtlksgrvvpgyghgvlrkpdprfqalmdfaatrpdvlanpvfqlvkknseia pavltehgktknphpnvdaasgvlfyhygfqqplyytvtfgvsralgplvqliwdralgl pierpksinllglkk
Timeline for d5uqrb_: