SCOPe 2.08: Domain d5uead_: 5uea D:

Lineage for d5uead_ (5uea D:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.22: ASF1-like [101546] (2 families)
   contains extra C-terminal strand
   automatically mapped to Pfam PF04729

5. Family b.1.22.1: ASF1-like [101547] (2 proteins)

6. Protein automated matches [195145] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [347659] (6 PDB entries)

8. Domain d5uead_: 5uea D: [347660]
   Other proteins in same PDB: d5ueaa_, d5ueab1, d5ueab2, d5ueah_, d5ueal1, d5ueal2
   automated match to d2dzea_

Details for d5uead_

PDB Entry: 5uea, 1.7 Å

PDB Description: structure of antigen-fab complex with histone chaperone asf1

PDB Compounds: (D:) histone chaperone asf1

SCOPe Domain Sequences for d5uead_:

Sequence, based on SEQRES records:

>d5uead_ b.1.22.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsil
vgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeee
lrenppakvqvdhivrnilaekprvtrfnivwd

Sequence, based on observed residues (ATOM records):

>d5uead_ b.1.22.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgqeldsilvgpvpvgv
nkfvfsadppssvtvillscsydgrefvrvgyyvnneydeeelrenppakvqvdhivrni
laekprvtrfnivwd

Timeline for d5uead_:

• d5uead_ first appeared in SCOPe 2.07