Lineage for d5uqsc_ (5uqs C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722943Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2722944Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2722945Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2723011Protein automated matches [190675] (10 species)
    not a true protein
  7. 2723035Species Pig (Sus scrofa) [TaxId:9823] [347647] (1 PDB entry)
  8. 2723037Domain d5uqsc_: 5uqs C: [347648]
    automated match to d3enja_
    complexed with cl

Details for d5uqsc_

PDB Entry: 5uqs (more details), 1.6 Å

PDB Description: crystal structure of citrate synthase from sus scrofa
PDB Compounds: (C:) Citrate synthase, mitochondrial

SCOPe Domain Sequences for d5uqsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uqsc_ a.103.1.1 (C:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
stnlkdiladlipkeqariktfrqqhgntvvgqitvdmmyggmrgmkglvyetsvldpde
girfrgysipecqkmlpkakggeeplpeglfwllvtgqipteeqvswlskewakraalps
hvvtmldnfptnlhpmsqlsaaitalnsesnfarayaegihrtkyweliyedcmdliakl
pcvaakiyrnlyregssigaidskldwshnftnmlgytdaqftelmrlyltihsdheggn
vsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdeklr
dyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlphdpmfklvaqlykivpnvll
eqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerp
ksmstdgliklvds

SCOPe Domain Coordinates for d5uqsc_:

Click to download the PDB-style file with coordinates for d5uqsc_.
(The format of our PDB-style files is described here.)

Timeline for d5uqsc_: