![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.103.1: Citrate synthase [48256] (2 families) ![]() |
![]() | Family a.103.1.1: Citrate synthase [48257] (2 proteins) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain automatically mapped to Pfam PF00285 |
![]() | Protein automated matches [190675] (10 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [347647] (1 PDB entry) |
![]() | Domain d5uqsc_: 5uqs C: [347648] automated match to d3enja_ complexed with cl |
PDB Entry: 5uqs (more details), 1.6 Å
SCOPe Domain Sequences for d5uqsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uqsc_ a.103.1.1 (C:) automated matches {Pig (Sus scrofa) [TaxId: 9823]} stnlkdiladlipkeqariktfrqqhgntvvgqitvdmmyggmrgmkglvyetsvldpde girfrgysipecqkmlpkakggeeplpeglfwllvtgqipteeqvswlskewakraalps hvvtmldnfptnlhpmsqlsaaitalnsesnfarayaegihrtkyweliyedcmdliakl pcvaakiyrnlyregssigaidskldwshnftnmlgytdaqftelmrlyltihsdheggn vsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdeklr dyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlphdpmfklvaqlykivpnvll eqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerp ksmstdgliklvds
Timeline for d5uqsc_: