Lineage for d1thga1 (1thg A:2-544)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135098Family c.69.1.17: Fungal lipases [53558] (5 protein domains)
  6. 2135196Protein Type-B carboxylesterase/lipase [53566] (4 species)
  7. 2135215Species Fungus (Geotrichum candidum), ATCC 34614 [TaxId:27317] [53567] (1 PDB entry)
  8. 2135216Domain d1thga1: 1thg A:2-544 [34763]
    Other proteins in same PDB: d1thga2
    complexed with nag, ndg

Details for d1thga1

PDB Entry: 1thg (more details), 1.8 Å

PDB Description: 1.8 angstroms refined structure of the lipase from geotrichum candidum
PDB Compounds: (A:) lipase 2

SCOPe Domain Sequences for d1thga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1thga1 c.69.1.17 (A:2-544) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]}
aptavlngnevisgvlegkvdtfkgipfadpplndlrfkhpqpftgsyqglkandfspac
mqldpgnsltlldkalglakvipeefrgplydmakgtvsmnedclylnvfrpagtkpdak
lpvmvwiyggafvygssaaypgnsyvkesinmgqpvvfvsinyrtgpfgflggdaitaeg
ntnaglhdqrkglewvsdnianfggdpdkvmifgesagamsvahqliayggdntyngkkl
fhsailqsggplpyhdsssvgpdisynrfaqyagcdtsasandtleclrsksssvlhdaq
nsydlkdlfgllpqflgfgprpdgniipdaayelfrsgryakvpyisgnqedegtafapv
alnatttphvkkwlqyifydaseasidrvlslypqtlsvgspfrtgilnaltpqfkrvaa
ilsdmlfqsprrvmlsatkdvnrwtylsthlhnlvpflgtfhgnelifqfnvnigpansy
lryfisfanhhdpnvgtnllqwdqytdegkemleihmtdnvmrtddyriegisnfetdvn
lyg

SCOPe Domain Coordinates for d1thga1:

Click to download the PDB-style file with coordinates for d1thga1.
(The format of our PDB-style files is described here.)

Timeline for d1thga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1thga2