Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d5ueab2: 5uea B:108-211 [347620] Other proteins in same PDB: d5ueaa_, d5ueab1, d5uead_, d5ueah_, d5ueal1, d5ueax_ automated match to d4jg1l2 |
PDB Entry: 5uea (more details), 1.7 Å
SCOPe Domain Sequences for d5ueab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ueab2 b.1.1.2 (B:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d5ueab2: