Lineage for d1ticb_ (1tic B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1870058Family c.69.1.17: Fungal lipases [53558] (5 proteins)
  6. 1870074Protein Triacylglycerol lipase [53559] (7 species)
  7. 1870087Species Rhizopus delemar [TaxId:64495] [53565] (1 PDB entry)
  8. 1870089Domain d1ticb_: 1tic B: [34762]
    CA-atoms only

Details for d1ticb_

PDB Entry: 1tic (more details), 2.6 Å

PDB Description: conformational lability of lipases observed in the absence of an oil- water interface: crystallographic studies of enzymes from the fungi humicola lanuginosa and rhizopus delemar
PDB Compounds: (B:) Lipase

SCOPe Domain Sequences for d1ticb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ticb_ c.69.1.17 (B:) Triacylglycerol lipase {Rhizopus delemar [TaxId: 64495]}
sdggkvvaattaqiqeftkyagiaataycrsvvpgnkwdcvqcqkwvpdgkiittftsll
sdtngyvlrsdkqktiylvfrgtnsfrsaitdivfnfsdykpvkgakvhagflssyeqvv
ndyfpvvqeqltahptykvivtghslggaqallagmdlyqreprlspknlsiftvggprv
gnptfayyvestgipfqrtvhkrdivphvppqsfgflhpgveswiksgtsnvqictseie
tkdcsnsivpftsildhlsyfdinegscl

SCOPe Domain Coordinates for d1ticb_:

Click to download the PDB-style file with coordinates for d1ticb_.
(The format of our PDB-style files is described here.)

Timeline for d1ticb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tica_