Lineage for d1lgyc_ (1lgy C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26848Family c.69.1.17: Fungal lipases [53558] (2 proteins)
  6. 26849Protein Triacylglycerol lipase [53559] (6 species)
  7. 26860Species Rhizopus niveus [TaxId:4844] [53564] (1 PDB entry)
  8. 26863Domain d1lgyc_: 1lgy C: [34760]

Details for d1lgyc_

PDB Entry: 1lgy (more details), 2.2 Å

PDB Description: lipase ii from rhizopus niveus

SCOP Domain Sequences for d1lgyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lgyc_ c.69.1.17 (C:) Triacylglycerol lipase {Rhizopus niveus}
kvvaattaqiqeftkyagiaataycrsvvpgnkwdcvqcqkwvpdgkiittftsllsdtn
gyvlrsdkqktiylvfrgtnsfrsaitdivfnfsdykpvkgakvhagflssyeqvvndyf
pvvqeqltahptykvivtghslggaqallagmdlyqreprlspknlsiftvggprvgnpt
fayyvestgipfqrtvhkrdivphvppqsfgflhpgveswiksgtsnvqictseietkdc
snsivpftsildhlsyfdinegscl

SCOP Domain Coordinates for d1lgyc_:

Click to download the PDB-style file with coordinates for d1lgyc_.
(The format of our PDB-style files is described here.)

Timeline for d1lgyc_: