Lineage for d5uc4d_ (5uc4 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973216Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2973542Protein automated matches [190229] (13 species)
    not a true protein
  7. 2973575Species Human (Homo sapiens) [TaxId:9606] [187292] (114 PDB entries)
  8. 2973693Domain d5uc4d_: 5uc4 D: [347585]
    Other proteins in same PDB: d5uc4a2, d5uc4c2
    automated match to d1uyma_
    complexed with 83s, dms, gol

Details for d5uc4d_

PDB Entry: 5uc4 (more details), 2.05 Å

PDB Description: hsp90b n-terminal domain with inhibitors
PDB Compounds: (D:) heat shock protein hsp 90-beta

SCOPe Domain Sequences for d5uc4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uc4d_ d.122.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeevetfafqaeiaqlmsliintfysnkeiflrelisnasdaldkiryesltdpskldsg
kelkidiipnpqertltlvdtgigmtkadlinnlgtiaksgtkafmealqagadismigq
fgvgfysaylvaekvvvitkhnddeqyawessaggsftvradhgepigrgtkvilhlked
qteyleerrvkevvkkhsqfigypitlyl

SCOPe Domain Coordinates for d5uc4d_:

Click to download the PDB-style file with coordinates for d5uc4d_.
(The format of our PDB-style files is described here.)

Timeline for d5uc4d_: