Lineage for d1lgya_ (1lgy A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73651Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 73652Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 73883Family c.69.1.17: Fungal lipases [53558] (2 proteins)
  6. 73884Protein Triacylglycerol lipase [53559] (6 species)
  7. 73895Species Rhizopus niveus [TaxId:4844] [53564] (1 PDB entry)
  8. 73896Domain d1lgya_: 1lgy A: [34758]

Details for d1lgya_

PDB Entry: 1lgy (more details), 2.2 Å

PDB Description: lipase ii from rhizopus niveus

SCOP Domain Sequences for d1lgya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus}
kvvaattaqiqeftkyagiaataycrsvvpgnkwdcvqcqkwvpdgkiittftsllsdtn
gyvlrsdkqktiylvfrgtnsfrsaitdivfnfsdykpvkgakvhagflssyeqvvndyf
pvvqeqltahptykvivtghslggaqallagmdlyqreprlspknlsiftvggprvgnpt
fayyvestgipfqrtvhkrdivphvppqsfgflhpgveswiksgtsnvqictseietkdc
snsivpftsildhlsyfdinegscl

SCOP Domain Coordinates for d1lgya_:

Click to download the PDB-style file with coordinates for d1lgya_.
(The format of our PDB-style files is described here.)

Timeline for d1lgya_: