Lineage for d1lgya_ (1lgy A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) 
Family c.69.1.17: Fungal lipases [53558] (2 proteins) Protein Triacylglycerol lipase [53559] (6 species) 
Species Rhizopus niveus [TaxId:4844] [53564] (1 PDB entry) 
Domain d1lgya_: 1lgy A: [34758]
Details for d1lgya_
PDB Entry: 1lgy (more details), 2.2 Å
PDB Description: lipase ii from rhizopus niveus
SCOP Domain Sequences for d1lgya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus}
kvvaattaqiqeftkyagiaataycrsvvpgnkwdcvqcqkwvpdgkiittftsllsdtn
gyvlrsdkqktiylvfrgtnsfrsaitdivfnfsdykpvkgakvhagflssyeqvvndyf
pvvqeqltahptykvivtghslggaqallagmdlyqreprlspknlsiftvggprvgnpt
fayyvestgipfqrtvhkrdivphvppqsfgflhpgveswiksgtsnvqictseietkdc
snsivpftsildhlsyfdinegscl
SCOP Domain Coordinates for d1lgya_:
Click to download the PDB-style file with coordinates for d1lgya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lgya_:
- d1lgya_ appears in SCOP 1.57
- d1lgya_ appears in the current release, SCOPe 2.08
View in 3D
