![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.17: Fungal lipases [53558] (5 proteins) |
![]() | Protein Triacylglycerol lipase [53559] (7 species) |
![]() | Species Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId:5541] [53563] (26 PDB entries) |
![]() | Domain d1einb_: 1ein B: [34756] complexed with plc |
PDB Entry: 1ein (more details), 3 Å
SCOPe Domain Sequences for d1einb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1einb_ c.69.1.17 (B:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} evsqdlfnqfnlfaqysaaaycgknndapagtnitctgnacpevekadatflysfedsgv gdvtgflaldntnklivlsfrgsrsienwignlnfdlkeindicsgcrghdgftsswrsv adtlrqkvedavrehpdyrvvftghslggalatvagadlrgngydidvfsygaprvgnra faefltvqtggtlyrithtndivprlpprefgyshsspeywiksgtlvpvtrndivkieg idatggnnqpnipdipahlwyfgligtcl
Timeline for d1einb_: