Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Protein kinase CK2, alpha subunit [56142] (3 species) CMGC group; CK2 subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [75559] (184 PDB entries) |
Domain d5ot5b_: 5ot5 B: [347517] automated match to d3at4a_ complexed with act, awk, peg, po4 |
PDB Entry: 5ot5 (more details), 1.63 Å
SCOPe Domain Sequences for d5ot5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ot5b_ d.144.1.7 (B:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]} gpvpsrarvytdvnthrpseywdyeshvvewgnqddyqlvrklgrgkysevfeainitnn ekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfk qlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefy hpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydql vriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfld kllrydhqsrltareamehpyfytv
Timeline for d5ot5b_: