SCOPe 2.07: Domain d5ouub_: 5ouu B:

Lineage for d5ouub_ (5ouu B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
   CMGC group; CK2 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [75559] (180 PDB entries)

8. Domain d5ouub_: 5ouu B: [347472]
   automated match to d3at4a_
   complexed with act, awn, po4

Details for d5ouub_

PDB Entry: 5ouu, 1.81 Å

PDB Description: the crystal structure of ck2alpha in complex with compound 22

PDB Compounds: (B:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d5ouub_:

Sequence; same for both SEQRES and ATOM records:

>d5ouub_ d.144.1.7 (B:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
gpvpsrarvytdvnthrpseywdyeshvvewgnqddyqlvrklgrgkysevfeainitnn
ekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfk
qlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefy
hpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydql
vriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfld
kllrydhqsrltareamehpyfytv

Timeline for d5ouub_:

• d5ouub_ is new in SCOPe 2.07-stable
  
• d5ouub_ appears in the current release, SCOPe 2.08