Lineage for d5qadd_ (5qad D:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014498Species Klebsiella pneumoniae [TaxId:573] [225260] (114 PDB entries)
  8. 3014572Domain d5qadd_: 5qad D: [347442]
    automated match to d4s2kb_
    complexed with cl, edo, wvv

Details for d5qadd_

PDB Entry: 5qad (more details), 1.75 Å

PDB Description: oxa-48 in complex with compound 8a
PDB Compounds: (D:) Beta-lactamase

SCOPe Domain Sequences for d5qadd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qadd_ e.3.1.0 (D:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
ewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdl
gvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafd
ygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdy
iiraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqeki
ip

SCOPe Domain Coordinates for d5qadd_:

Click to download the PDB-style file with coordinates for d5qadd_.
(The format of our PDB-style files is described here.)

Timeline for d5qadd_: