Lineage for d5ogib2 (5ogi B:124-240)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761100Domain d5ogib2: 5ogi B:124-240 [347408]
    Other proteins in same PDB: d5ogia1, d5ogia2, d5ogib3
    automated match to d4f9lc2
    complexed with dio, edo, mes, so4

Details for d5ogib2

PDB Entry: 5ogi (more details), 2.8 Å

PDB Description: complex of a binding protein and human adenovirus c 5 hexon
PDB Compounds: (B:) scFv of 9C12 antibody

SCOPe Domain Sequences for d5ogib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ogib2 b.1.1.0 (B:124-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlvqsgaedkkpgasvkvsckvsgfslgrygvhwvrqapgqglewmgviwrggttdyn
akfqgrvtitkddskstvymelsslrsedtavyycarqgsnfplaywgqgtlvtvss

SCOPe Domain Coordinates for d5ogib2:

Click to download the PDB-style file with coordinates for d5ogib2.
(The format of our PDB-style files is described here.)

Timeline for d5ogib2: