Lineage for d1tia__ (1tia -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73651Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 73652Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 73883Family c.69.1.17: Fungal lipases [53558] (2 proteins)
  6. 73884Protein Triacylglycerol lipase [53559] (6 species)
  7. 73885Species Penicillium camembertii [TaxId:5075] [53562] (1 PDB entry)
  8. 73886Domain d1tia__: 1tia - [34737]

Details for d1tia__

PDB Entry: 1tia (more details), 2 Å

PDB Description: an unusual buried polar cluster in a family of fungal lipases

SCOP Domain Sequences for d1tia__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tia__ c.69.1.17 (-) Triacylglycerol lipase {Penicillium camembertii}
dvstseldqfefwvqyaaasyyeadytaqvgdklscskgncpeveatgatvsydfsdsti
tdtagyiavdhtnsavvlafrgsysvrnwvadatfvhtnpglcdgclaelgfwsswklvr
ddiikelkevvaqnpnyelvvvghslgaavatlaatdlrgkgypsaklyayasprvgnaa
lakyitaqgnnfrfthtndpvpklpllsmgyvhvspeywitspnnatvstsdikvidgdv
sfdgntgtglplltdfeahiwyfvqvdagkg

SCOP Domain Coordinates for d1tia__:

Click to download the PDB-style file with coordinates for d1tia__.
(The format of our PDB-style files is described here.)

Timeline for d1tia__: