Lineage for d5tgl__ (5tgl -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26848Family c.69.1.17: Fungal lipases [53558] (2 proteins)
  6. 26849Protein Triacylglycerol lipase [53559] (6 species)
  7. 26852Species Rhizomucor miehei [TaxId:4839] [53561] (4 PDB entries)
  8. 26856Domain d5tgl__: 5tgl - [34736]

Details for d5tgl__

PDB Entry: 5tgl (more details), 3 Å

PDB Description: a model for interfacial activation in lipases from the structure of a fungal lipase-inhibitor complex

SCOP Domain Sequences for d5tgl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tgl__ c.69.1.17 (-) Triacylglycerol lipase {Rhizomucor miehei}
giraatsqeineltyyttlsansycrtvipgatwdcihcdatedlkiiktwstliydtna
mvargdsektiyivfrgsssirnwiadltfvpvsyppvsgtkvhkgfldsygevqnelva
tvldqfkqypsykvavtghslggatallcaldlyqreeglsssnlflytqgqprvgnpaf
anyvvstgipyrrtvnerdivphlppaafgflhagseywitdnspetvqvctsdletsdc
snsivpftsvldhlsyfgintglct

SCOP Domain Coordinates for d5tgl__:

Click to download the PDB-style file with coordinates for d5tgl__.
(The format of our PDB-style files is described here.)

Timeline for d5tgl__: