SCOPe 2.06: Domain d4tgla_: 4tgl A:

Lineage for d4tgla_ (4tgl A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.17: Fungal lipases [53558] (5 proteins)

6. Protein Triacylglycerol lipase [53559] (7 species)

7. Species Rhizomucor miehei [TaxId:4839] [53561] (4 PDB entries)

8. Domain d4tgla_: 4tgl A: [34735]
   complexed with dep

Details for d4tgla_

PDB Entry: 4tgl, 2.6 Å

PDB Description: catalysis at the interface: the anatomy of a conformational change in a triglyceride lipase

PDB Compounds: (A:) triacyl-glycerol acylhydrolase

SCOPe Domain Sequences for d4tgla_:

Sequence; same for both SEQRES and ATOM records:

>d4tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]}
giraatsqeineltyyttlsansycrtvipgatwdcihcdatedlkiiktwstliydtna
mvargdsektiyivfrgsssirnwiadltfvpvsyppvsgtkvhkgfldsygevqnelva
tvldqfkqypsykvavtghslggatallcaldlyqreeglsssnlflytqgqprvgnpaf
anyvvstgipyrrtvnerdivphlppaafgflhagseywitdnspetvqvctsdletsdc
snsivpftsvldhlsyfgintglct

Timeline for d4tgla_:

• d4tgla_ first appeared (with stable ids) in SCOP 1.55, called d4tgl__
  
• d4tgla_ appears in SCOPe 2.05
  
• d4tgla_ appears in SCOPe 2.07
  
• d4tgla_ appears in the current release, SCOPe 2.08