Lineage for d4tgl__ (4tgl -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) 
Family c.69.1.17: Fungal lipases [53558] (2 proteins) Protein Triacylglycerol lipase [53559] (6 species) 
Species Rhizomucor miehei [TaxId:4839] [53561] (4 PDB entries) 
Domain d4tgl__: 4tgl - [34735]
Details for d4tgl__
PDB Entry: 4tgl (more details), 2.6 Å
PDB Description: catalysis at the interface: the anatomy of a conformational change in a triglyceride lipase
SCOP Domain Sequences for d4tgl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tgl__ c.69.1.17 (-) Triacylglycerol lipase {Rhizomucor miehei}
giraatsqeineltyyttlsansycrtvipgatwdcihcdatedlkiiktwstliydtna
mvargdsektiyivfrgsssirnwiadltfvpvsyppvsgtkvhkgfldsygevqnelva
tvldqfkqypsykvavtghslggatallcaldlyqreeglsssnlflytqgqprvgnpaf
anyvvstgipyrrtvnerdivphlppaafgflhagseywitdnspetvqvctsdletsdc
snsivpftsvldhlsyfgintglct
SCOP Domain Coordinates for d4tgl__:
Click to download the PDB-style file with coordinates for d4tgl__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4tgl__:
- d4tgl__ first appeared (with stable ids) in SCOP 1.55
- d4tgl__ appears in SCOP 1.59
- d4tgl__ appears in the current release, SCOPe 2.08, called d4tgla_
View in 3D