Lineage for d1tgl__ (1tgl -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) 
Family c.69.1.17: Fungal lipases [53558] (2 proteins) Protein Triacylglycerol lipase [53559] (6 species) 
Species Rhizomucor miehei [TaxId:4839] [53561] (4 PDB entries) 
Domain d1tgl__: 1tgl - [34734]
Details for d1tgl__
PDB Entry: 1tgl (more details), 1.9 Å
PDB Description: a serine protease triad forms the catalytic centre of a triacylglycerol lipase
SCOP Domain Sequences for d1tgl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tgl__ c.69.1.17 (-) Triacylglycerol lipase {Rhizomucor miehei}
giraatsqeineltyyttlsansycrtvipgatwdcihcdatedlkiiktwstliydtna
mvargdsektiyivfrgsssirnwiadltfvpvsyppvsgtkvhkgfldsygevqnelva
tvldqfkqypsykvavtghslggatallcaldlyqreeglsssnlflytqgqprvgnpaf
anyvvstgipyrrtvnerdivphlppaafgflhagseywitdnspetvqvctsdletsdc
snsivpftsvldhlsyfgintglcs
SCOP Domain Coordinates for d1tgl__:
Click to download the PDB-style file with coordinates for d1tgl__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tgl__:
- d1tgl__ appears in SCOP 1.57
- d1tgl__ appears in the current release, SCOPe 2.08, called d1tgla_
View in 3D