Lineage for d1tgla_ (1tgl A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900758Family c.69.1.17: Fungal lipases [53558] (5 proteins)
  6. 2900774Protein Triacylglycerol lipase [53559] (7 species)
  7. 2900793Species Rhizomucor miehei [TaxId:4839] [53561] (4 PDB entries)
  8. 2900795Domain d1tgla_: 1tgl A: [34734]
    CA-atoms only

Details for d1tgla_

PDB Entry: 1tgl (more details), 1.9 Å

PDB Description: a serine protease triad forms the catalytic centre of a triacylglycerol lipase
PDB Compounds: (A:) triacyl-glycerol acylhydrolase

SCOPe Domain Sequences for d1tgla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]}
giraatsqeineltyyttlsansycrtvipgatwdcihcdatedlkiiktwstliydtna
mvargdsektiyivfrgsssirnwiadltfvpvsyppvsgtkvhkgfldsygevqnelva
tvldqfkqypsykvavtghslggatallcaldlyqreeglsssnlflytqgqprvgnpaf
anyvvstgipyrrtvnerdivphlppaafgflhagseywitdnspetvqvctsdletsdc
snsivpftsvldhlsyfgintglcs

SCOPe Domain Coordinates for d1tgla_:

Click to download the PDB-style file with coordinates for d1tgla_.
(The format of our PDB-style files is described here.)

Timeline for d1tgla_: