Lineage for d3tgl__ (3tgl -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73651Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 73652Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 73883Family c.69.1.17: Fungal lipases [53558] (2 proteins)
  6. 73884Protein Triacylglycerol lipase [53559] (6 species)
  7. 73887Species Rhizomucor miehei [TaxId:4839] [53561] (4 PDB entries)
  8. 73888Domain d3tgl__: 3tgl - [34733]

Details for d3tgl__

PDB Entry: 3tgl (more details), 1.9 Å

PDB Description: structure and molecular model refinement of rhizomucor miehei triacylglyceride lipase: a case study of the use of simulated annealing in partial model refinement

SCOP Domain Sequences for d3tgl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tgl__ c.69.1.17 (-) Triacylglycerol lipase {Rhizomucor miehei}
giraatsqeineltyyttlsansycrtvipgatwdcihcdatedlkiiktwstliydtna
mvargdsektiyivfrgsssirnwiadltfvpvsyppvsgtkvhkgfldsygevqnelva
tvldqfkqypsykvavtghslggatvllcaldlyqreeglsssnlflytqgqprvgdpaf
anyvvstgipyrrtvnerdivphlppaafgflhageeywitdnspetvqvctsdletsdc
snsivpftsvldhlsyfgintglct

SCOP Domain Coordinates for d3tgl__:

Click to download the PDB-style file with coordinates for d3tgl__.
(The format of our PDB-style files is described here.)

Timeline for d3tgl__: