Lineage for d3tgl__ (3tgl -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26848Family c.69.1.17: Fungal lipases [53558] (2 proteins)
  6. 26849Protein Triacylglycerol lipase [53559] (6 species)
  7. 26852Species Rhizomucor miehei [TaxId:4839] [53561] (4 PDB entries)
  8. 26853Domain d3tgl__: 3tgl - [34733]

Details for d3tgl__

PDB Entry: 3tgl (more details), 1.9 Å

PDB Description: structure and molecular model refinement of rhizomucor miehei triacylglyceride lipase: a case study of the use of simulated annealing in partial model refinement

SCOP Domain Sequences for d3tgl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tgl__ c.69.1.17 (-) Triacylglycerol lipase {Rhizomucor miehei}
giraatsqeineltyyttlsansycrtvipgatwdcihcdatedlkiiktwstliydtna
mvargdsektiyivfrgsssirnwiadltfvpvsyppvsgtkvhkgfldsygevqnelva
tvldqfkqypsykvavtghslggatvllcaldlyqreeglsssnlflytqgqprvgdpaf
anyvvstgipyrrtvnerdivphlppaafgflhageeywitdnspetvqvctsdletsdc
snsivpftsvldhlsyfgintglct

SCOP Domain Coordinates for d3tgl__:

Click to download the PDB-style file with coordinates for d3tgl__.
(The format of our PDB-style files is described here.)

Timeline for d3tgl__: