![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.17: Fungal lipases [53558] (5 proteins) |
![]() | Protein Triacylglycerol lipase [53559] (7 species) |
![]() | Species Rhizomucor miehei [TaxId:4839] [53561] (4 PDB entries) |
![]() | Domain d3tgla_: 3tgl A: [34733] |
PDB Entry: 3tgl (more details), 1.9 Å
SCOPe Domain Sequences for d3tgla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} giraatsqeineltyyttlsansycrtvipgatwdcihcdatedlkiiktwstliydtna mvargdsektiyivfrgsssirnwiadltfvpvsyppvsgtkvhkgfldsygevqnelva tvldqfkqypsykvavtghslggatvllcaldlyqreeglsssnlflytqgqprvgdpaf anyvvstgipyrrtvnerdivphlppaafgflhageeywitdnspetvqvctsdletsdc snsivpftsvldhlsyfgintglct
Timeline for d3tgla_: