SCOPe 2.07: Domain d5ovaa1: 5ova A:580-674

Lineage for d5ovaa1 (5ova A:580-674)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186775] (10 PDB entries)

8. Domain d5ovaa1: 5ova A:580-674 [347318]
   Other proteins in same PDB: d5ovaa2, d5ovab2
   automated match to d3o5nf_

Details for d5ovaa1

PDB Entry: 5ova, 2.3 Å

PDB Description: apo pdz domain from rat shank3

PDB Compounds: (A:) SH3 and multiple ankyrin repeat domains protein 3

SCOPe Domain Sequences for d5ovaa1:

Sequence, based on SEQRES records:

>d5ovaa1 b.36.1.1 (A:580-674) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vailqkrdhegfgfvlrgakaetpieeftptpafpalqylesvdvegvawkaglrtgdfl
ievngvnvvkvghkqvvglirqggnrlvmkvvsvt

Sequence, based on observed residues (ATOM records):

>d5ovaa1 b.36.1.1 (A:580-674) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vailqkrdhegfgfvlrgapieeftptpafpalqylesvdvegvawkaglrtgdflievn
gvnvvkvghkqvvglirqggnrlvmkvvsvt

Timeline for d5ovaa1:

• d5ovaa1 is new in SCOPe 2.07-stable
  
• d5ovaa1 appears in the current release, SCOPe 2.08