Lineage for d5ovaa1 (5ova A:580-674)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395833Protein automated matches [190055] (6 species)
    not a true protein
  7. 2395982Species Norway rat (Rattus norvegicus) [TaxId:10116] [186775] (10 PDB entries)
  8. 2395996Domain d5ovaa1: 5ova A:580-674 [347318]
    Other proteins in same PDB: d5ovaa2, d5ovab2
    automated match to d3o5nf_

Details for d5ovaa1

PDB Entry: 5ova (more details), 2.3 Å

PDB Description: apo pdz domain from rat shank3
PDB Compounds: (A:) SH3 and multiple ankyrin repeat domains protein 3

SCOPe Domain Sequences for d5ovaa1:

Sequence, based on SEQRES records: (download)

>d5ovaa1 b.36.1.1 (A:580-674) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vailqkrdhegfgfvlrgakaetpieeftptpafpalqylesvdvegvawkaglrtgdfl
ievngvnvvkvghkqvvglirqggnrlvmkvvsvt

Sequence, based on observed residues (ATOM records): (download)

>d5ovaa1 b.36.1.1 (A:580-674) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vailqkrdhegfgfvlrgapieeftptpafpalqylesvdvegvawkaglrtgdflievn
gvnvvkvghkqvvglirqggnrlvmkvvsvt

SCOPe Domain Coordinates for d5ovaa1:

Click to download the PDB-style file with coordinates for d5ovaa1.
(The format of our PDB-style files is described here.)

Timeline for d5ovaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ovaa2