Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (22 species) not a true protein |
Species Murine norovirus gv/cr10/2005/usa [TaxId:463724] [347267] (1 PDB entry) |
Domain d5or7b_: 5or7 B: [347315] Other proteins in same PDB: d5or7c_ automated match to d1ihmb_ complexed with na |
PDB Entry: 5or7 (more details), 2.05 Å
SCOPe Domain Sequences for d5or7b_:
Sequence, based on SEQRES records: (download)
>d5or7b_ b.121.4.0 (B:) automated matches {Murine norovirus gv/cr10/2005/usa [TaxId: 463724]} rmvdlpvlqprlctharwpapiygllvdpslpsnpqwqngrvhvdgtllgttpvsgswvs cfaaeaayefqsgtgevatftlieqdgsayvpgdraaplgypdfsgqleievqtettktg dklkvttfemilgpttnvdqapyqgrvyasltavasldlvdgrvravprsiygfqdvipe yndgllvplappigpflpgevllrfrtymrqldtadaaaeaidcalpqefiswfasnaft vqsdalllryrntltgqllfecklysegyialsysgsgpltfptdgffevvswvprlfql asv
>d5or7b_ b.121.4.0 (B:) automated matches {Murine norovirus gv/cr10/2005/usa [TaxId: 463724]} rmvdlpvlqprlctharwpapiygllvdpslpsnpqwqngrvhvdgtllgttpvsgswvs cfaaeaayefqstgevatftlieqdgsayvpgdraaplgypdfsgqleievqtetklkvt tfemilgptdqapyqgrvyasltaasldlvdgrvravprsiygfqdvipeyndgllvpla ppigpflpgevllrfrtymrqldtadaaaeaidcalpqefiswfasnaftvqsdalllry rntltgqllfecklysegyialsysgsgpltfptdgffevvswvprlfqlasv
Timeline for d5or7b_: