Class l: Artifacts [310555] (1 fold) |
Fold l.1: Tags [310573] (1 superfamily) |
Superfamily l.1.1: Tags [310607] (1 family) |
Family l.1.1.1: Tags [310682] (2 proteins) |
Protein C-terminal Tags [310895] (1 species) |
Species Synthetic [311502] (5516 PDB entries) |
Domain d5o7lb2: 5o7l B:53-96 [347313] Other proteins in same PDB: d5o7la1, d5o7lb1 complexed with so4; mutant |
PDB Entry: 5o7l (more details), 2.6 Å
SCOPe Domain Sequences for d5o7lb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o7lb2 l.1.1.1 (B:53-96) C-terminal Tags {Synthetic} reikgyeyqlyvrasdklfradisedyktrgrkllrfngpvppp
Timeline for d5o7lb2: