SCOPe 2.07: Domain d5o7lb2: 5o7l B:53-96

Lineage for d5o7lb2 (5o7l B:53-96)

1. Root: SCOPe 2.07

2. Class l: Artifacts [310555] (1 fold)

3. Fold l.1: Tags [310573] (1 superfamily)

4. Superfamily l.1.1: Tags [310607] (1 family)

5. Family l.1.1.1: Tags [310682] (2 proteins)

6. Protein C-terminal Tags [310895] (1 species)

7. Species Synthetic [311502] (5516 PDB entries)

8. Domain d5o7lb2: 5o7l B:53-96 [347313]
   Other proteins in same PDB: d5o7la1, d5o7lb1
   complexed with so4; mutant

Details for d5o7lb2

PDB Entry: 5o7l, 2.6 Å

PDB Description: crystal structure of a single chain monellin mutant (y65r) ph 4.6

PDB Compounds: (B:) Monellin chain B

SCOPe Domain Sequences for d5o7lb2:

Sequence; same for both SEQRES and ATOM records:

>d5o7lb2 l.1.1.1 (B:53-96) C-terminal Tags {Synthetic}
reikgyeyqlyvrasdklfradisedyktrgrkllrfngpvppp

Timeline for d5o7lb2:

• d5o7lb2 is new in SCOPe 2.07-stable
  
• d5o7lb2 does not appear in SCOPe 2.08