![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (26 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.17: Fungal lipases [53558] (2 proteins) |
![]() | Protein Triacylglycerol lipase [53559] (6 species) |
![]() | Species Yeast (Candida antarctica), form b [TaxId:34362] [53560] (5 PDB entries) |
![]() | Domain d1tccb_: 1tcc B: [34731] complexed with bog, nag |
PDB Entry: 1tcc (more details), 2.5 Å
SCOP Domain Sequences for d1tccb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tccb_ c.69.1.17 (B:) Triacylglycerol lipase {Yeast (Candida antarctica), form b} lpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplstqlg ytpcwispppfmlndtqvnteymvnaitalyagsgnnklpvltwsqgglvaqwgltffps irskvdrlmafapdykgtvlagpldalavsapsvwqqttgsalttalrnaggltqivptt nlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgrsa lrsttgqarsadygitdcnplpandltpeqkvaaaallapaaaaivagpkqncepdlmpy arpfavgkrtcsgivtp
Timeline for d1tccb_: