Class g: Small proteins [56992] (98 folds) |
Fold g.12: LDL receptor-like module [57423] (1 superfamily) disulfide-rich calcium-binding fold |
Superfamily g.12.1: LDL receptor-like module [57424] (2 families) |
Family g.12.1.1: LDL receptor-like module [57425] (7 proteins) |
Protein automated matches [347306] (1 species) not a true protein |
Species Homo sapiens [TaxId:9606] [347307] (1 PDB entry) |
Domain d5oyld1: 5oyl D:44-85 [347308] Other proteins in same PDB: d5oyla_, d5oyld2 automated match to d1v9u5_ complexed with ca, gol, nag |
PDB Entry: 5oyl (more details), 2.25 Å
SCOPe Domain Sequences for d5oyld1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oyld1 g.12.1.1 (D:44-85) automated matches {Homo sapiens [TaxId: 9606]} svtcksgdfscggrvnrcipqfwrcdgqvdcdngsdeqgcpp
Timeline for d5oyld1: