Lineage for d5oyld1 (5oyl D:44-85)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033148Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 3033149Superfamily g.12.1: LDL receptor-like module [57424] (2 families) (S)
  5. 3033150Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)
  6. 3033160Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)
  7. 3033161Species Human (Homo sapiens) [TaxId:9606] [57427] (14 PDB entries)
    Uniprot P01130 272-353
  8. 3033166Domain d5oyld1: 5oyl D:44-85 [347308]
    Other proteins in same PDB: d5oyla_, d5oyld2
    automated match to d1v9u5_
    complexed with ca, gol, nag

Details for d5oyld1

PDB Entry: 5oyl (more details), 2.25 Å

PDB Description: vsv g cr2
PDB Compounds: (D:) low-density lipoprotein receptor

SCOPe Domain Sequences for d5oyld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oyld1 g.12.1.1 (D:44-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
svtcksgdfscggrvnrcipqfwrcdgqvdcdngsdeqgcpp

SCOPe Domain Coordinates for d5oyld1:

Click to download the PDB-style file with coordinates for d5oyld1.
(The format of our PDB-style files is described here.)

Timeline for d5oyld1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5oyld2
View in 3D
Domains from other chains:
(mouse over for more information)
d5oyla_