SCOPe 2.08: Domain d5oyld1: 5oyl D:44-85

Lineage for d5oyld1 (5oyl D:44-85)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.12: LDL receptor-like module [57423] (1 superfamily)
   disulfide-rich calcium-binding fold

4. Superfamily g.12.1: LDL receptor-like module [57424] (2 families)

5. Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)

6. Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57427] (14 PDB entries)
   Uniprot P01130 272-353

8. Domain d5oyld1: 5oyl D:44-85 [347308]
   Other proteins in same PDB: d5oyla_, d5oyld2
   automated match to d1v9u5_
   complexed with ca, gol, nag

Details for d5oyld1

PDB Entry: 5oyl, 2.25 Å

PDB Description: vsv g cr2

PDB Compounds: (D:) low-density lipoprotein receptor

SCOPe Domain Sequences for d5oyld1:

Sequence; same for both SEQRES and ATOM records:

>d5oyld1 g.12.1.1 (D:44-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
svtcksgdfscggrvnrcipqfwrcdgqvdcdngsdeqgcpp

Timeline for d5oyld1:

• d5oyld1 first appeared in SCOPe 2.07