Lineage for d5okdd1 (5okd D:2-195)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily)
core: 3 helices; folded leaf, openedSuperfamily a.3.1: Cytochrome c [46626] (9 families) 
covalently-bound heme completes the core
Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins) 
Protein automated matches [232767] (3 species)
not a true protein- Species Cow (Bos taurus) [TaxId:9913] [254893] (2 PDB entries)
Domain d5okdd1: 5okd D:2-195 [347263]
Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc1, d5okdc2, d5okdd2, d5okde1, d5okde2, d5okdg_, d5okdh_, d5okdi_, d5okdj_
automated match to d2a06d1
complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4
Details for d5okdd1
PDB Entry: 5okd (more details), 3.1 Å
PDB Description: crystal structure of bovine cytochrome bc1 in complex with inhibitor scr0911.
PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrialSCOPe Domain Sequences for d5okdd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5okdd1 a.3.1.3 (D:2-195) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytedea
kalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrarh
ggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatmsq
vakdvctflrwaae
SCOPe Domain Coordinates for d5okdd1:
Click to download the PDB-style file with coordinates for d5okdd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5okdd1:
View in 3D
