Lineage for d5ogia2 (5ogi A:635-946)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2430859Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
    trimeric; in the trimers, the domains are arranged around pseudo six-fold axis
  5. 2430949Family b.121.2.0: automated matches [227210] (1 protein)
    not a true family
  6. 2430950Protein automated matches [226945] (4 species)
    not a true protein
  7. 2430964Species Human adenovirus c serotype 5 [TaxId:28285] [347258] (1 PDB entry)
  8. 2430965Domain d5ogia2: 5ogi A:635-946 [347259]
    Other proteins in same PDB: d5ogia1, d5ogib1, d5ogib2, d5ogib3
    automated match to d1p2za2
    complexed with dio, edo, mes, so4

Details for d5ogia2

PDB Entry: 5ogi (more details), 2.8 Å

PDB Description: complex of a binding protein and human adenovirus c 5 hexon
PDB Compounds: (A:) hexon protein

SCOPe Domain Sequences for d5ogia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ogia2 b.121.2.0 (A:635-946) automated matches {Human adenovirus c serotype 5 [TaxId: 28285]}
ndtndqsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgy
dpyytysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegyn
vaqcnmtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyq
qvgilhqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripf
ssnfmsmgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgv
ietvylrtpfsa

SCOPe Domain Coordinates for d5ogia2:

Click to download the PDB-style file with coordinates for d5ogia2.
(The format of our PDB-style files is described here.)

Timeline for d5ogia2: