Lineage for d5or7c_ (5or7 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760166Domain d5or7c_: 5or7 C: [347253]
    Other proteins in same PDB: d5or7a_, d5or7b_
    automated match to d5ffla_
    complexed with na

Details for d5or7c_

PDB Entry: 5or7 (more details), 2.05 Å

PDB Description: atomic structure of the murine norovirus protruding domain and scd300lf receptor complex
PDB Compounds: (C:) CMRF35-like molecule 1

SCOPe Domain Sequences for d5or7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5or7c_ b.1.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
edpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkkn
rvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvp

SCOPe Domain Coordinates for d5or7c_:

Click to download the PDB-style file with coordinates for d5or7c_.
(The format of our PDB-style files is described here.)

Timeline for d5or7c_: