Lineage for d1jfra_ (1jfr A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) 
Family c.69.1.16: Lipase [53555] (1 protein) Protein Lipase [53556] (1 species) Species Streptomyces exfoliatus [TaxId:1905] [53557] (1 PDB entry) 
Domain d1jfra_: 1jfr A: [34724]
Details for d1jfra_
PDB Entry: 1jfr (more details), 1.9 Å
PDB Description: crystal structure of the streptomyces exfoliatus lipase at 1.9a resolution: a model for a family of platelet-activating factor acetylhydrolases
SCOP Domain Sequences for d1jfra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus}
npyergpaptnasieasrgpyatsqtsvsslvasgfgggtiyyptstadgtfgavvispg
ftayqssiawlgprlasqgfvvftidtnttldqpdsrgrqllsaldyltqrssvrtrvda
trlgvmghsmggggsleaaksrtslkaaipltgwntdktwpelrtptlvvgadgdtvapv
athskpfyeslpgsldkaylelrgashftpntsdttiakysiswlkrfidsdtryeqflc
piprpsltiaeyrgtcphts
SCOP Domain Coordinates for d1jfra_:
Click to download the PDB-style file with coordinates for d1jfra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jfra_:
- d1jfra_ appears in SCOP 1.57
- d1jfra_ appears in the current release, SCOPe 2.08
View in 3D
