Lineage for d5oinb_ (5oin B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2450398Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2450531Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (94 PDB entries)
  8. 2450744Domain d5oinb_: 5oin B: [347232]
    automated match to d2h9ia_
    complexed with 9w2, nad; mutant

Details for d5oinb_

PDB Entry: 5oin (more details), 2.82 Å

PDB Description: inha (t2a mutant) complexed with n-(1-(pyrimidin-2-yl)piperidin-4-yl) acetamide
PDB Compounds: (B:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d5oinb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oinb_ c.2.1.2 (B:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
ldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgihi
saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
gvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvaktv
callsdwlpattgdiiyadggahtqll

SCOPe Domain Coordinates for d5oinb_:

Click to download the PDB-style file with coordinates for d5oinb_.
(The format of our PDB-style files is described here.)

Timeline for d5oinb_: