Lineage for d1qlwb_ (1qlw B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 842413Family c.69.1.15: A novel bacterial esterase [53552] (1 protein)
  6. 842414Protein A novel bacterial esterase [53553] (1 species)
  7. 842415Species Alcaligenes sp. [TaxId:512] [53554] (1 PDB entry)
  8. 842417Domain d1qlwb_: 1qlw B: [34723]

Details for d1qlwb_

PDB Entry: 1qlw (more details), 1.09 Å

PDB Description: the atomic resolution structure of a novel bacterial esterase
PDB Compounds: (B:) esterase

SCOP Domain Sequences for d1qlwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlwb_ c.69.1.15 (B:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]}
vpktpagpltlsgqgsffvggrdvtsetlslspkydahgtvtvdqmyvryqipqrakryp
itlihgccltgmtwettpdgrmgwdeyflrkgystyvidqsgrgrsatdisainavklgk
apasslpdlfaagheaawaifrfgprypdafkdtqfpvqaqaelwqqmvpdwlgsmptpn
ptvanlsklaikldgtvllshsqsgiypfqtaamnpkgitaivsvepgecpkpedvkplt
sipvlvvfgdhieefprwaprlkachafidalnaaggkgqlmslpalgvhgnshmmmqdr
nnlqvadlildwigrnt

SCOP Domain Coordinates for d1qlwb_:

Click to download the PDB-style file with coordinates for d1qlwb_.
(The format of our PDB-style files is described here.)

Timeline for d1qlwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qlwa_