Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) Pfam PF00665 |
Protein automated matches [190209] (5 species) not a true protein |
Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (69 PDB entries) |
Domain d5oi5a_: 5oi5 A: [347227] automated match to d3vq9c_ complexed with 9vk, mg |
PDB Entry: 5oi5 (more details), 2.4 Å
SCOPe Domain Sequences for d5oi5a_:
Sequence, based on SEQRES records: (download)
>d5oi5a_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd ngsnftsttvkaacwwagikqefgipynpqsqgvvesmnkelkkiigqvrdqaehlktav qmavfihnkkrkggiggysagerivdiiatdi
>d5oi5a_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd ngsnftsttvkaacwwagikqmnkelkkiigqvrdqaehlktavqmavfihnkkrkysag erivdiiatdi
Timeline for d5oi5a_: