| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) ![]() |
| Family f.32.1.0: automated matches [254197] (1 protein) not a true family |
| Protein automated matches [254431] (4 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [254896] (2 PDB entries) |
| Domain d5okdc2: 5okd C:261-379 [347224] Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc1, d5okdd1, d5okdd2, d5okde1, d5okde2, d5okdg_, d5okdh_, d5okdi_, d5okdj_ automated match to d2a06c2 complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4 |
PDB Entry: 5okd (more details), 3.1 Å
SCOPe Domain Sequences for d5okdc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5okdc2 f.32.1.0 (C:261-379) automated matches {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw
Timeline for d5okdc2: