Lineage for d5ofsb_ (5ofs B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934668Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)
  7. 2934705Species Streptococcus sp., group G [TaxId:1306] [54361] (40 PDB entries)
  8. 2934713Domain d5ofsb_: 5ofs B: [347200]
    automated match to d2onqa_
    complexed with act, cl, edo, mpd, mrd, so4, zn; mutant

Details for d5ofsb_

PDB Entry: 5ofs (more details), 1.1 Å

PDB Description: x-ray structure of a zinc binding gb1 mutant
PDB Compounds: (B:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d5ofsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ofsb_ d.15.7.1 (B:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mqfklilngktlkgvitieavdhaeaekffkqyandngvdgewtydeathtftvte

SCOPe Domain Coordinates for d5ofsb_:

Click to download the PDB-style file with coordinates for d5ofsb_.
(The format of our PDB-style files is described here.)

Timeline for d5ofsb_: