Lineage for d1fj2a1 (1fj2 A:1-224)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900680Family c.69.1.14: Carboxylesterase/thioesterase 1 [53547] (5 proteins)
  6. 2900681Protein Acyl protein thioesterase 1 [53550] (1 species)
  7. 2900682Species Human (Homo sapiens) [TaxId:9606] [53551] (1 PDB entry)
  8. 2900683Domain d1fj2a1: 1fj2 A:1-224 [34720]
    Other proteins in same PDB: d1fj2a2, d1fj2b2
    complexed with br

Details for d1fj2a1

PDB Entry: 1fj2 (more details), 1.5 Å

PDB Description: crystal structure of the human acyl protein thioesterase 1 at 1.5 a resolution
PDB Compounds: (A:) protein (acyl protein thioesterase 1)

SCOPe Domain Sequences for d1fj2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fj2a1 c.69.1.14 (A:1-224) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]}
mstplpaivpaarkataaviflhglgdtghgwaeafagirsshikyicphapvrpvtlnm
nvampswfdiiglspdsqedesgikqaaenikalidqevkngipsnriilggfsqggals
lytalttqqklagvtalscwlplrasfpqgpigganrdisilqchgdcdplvplmfgslt
veklktlvnpanvtfktyegmmhsscqqemmdvkqfidkllppi

SCOPe Domain Coordinates for d1fj2a1:

Click to download the PDB-style file with coordinates for d1fj2a1.
(The format of our PDB-style files is described here.)

Timeline for d1fj2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fj2a2