SCOPe 2.07: Domain d5o9ac1: 5o9a C:3-263

Lineage for d5o9ac1 (5o9a C:3-263)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries)

8. Domain d5o9ac1: 5o9a C:3-263 [347197]
   Other proteins in same PDB: d5o9aa2, d5o9ab2, d5o9ac2, d5o9ad2
   automated match to d4h8ja_
   complexed with 7m6, cit, cl, edo, glu, gol, peg, so4

Details for d5o9ac1

PDB Entry: 5o9a, 1.78 Å

PDB Description: crystal structure of the glua2 ligand-binding domain (s1s2j-l504y- n775s) in complex with glutamate and bpam121 at 1.78 a resolution

PDB Compounds: (C:) Glutamate receptor 2,Glutamate receptor 2

SCOPe Domain Sequences for d5o9ac1:

Sequence; same for both SEQRES and ATOM records:

>d5o9ac1 c.94.1.1 (C:3-263) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltityvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkls
eqglldklknkwwydkgecgs

Timeline for d5o9ac1:

• d5o9ac1 is new in SCOPe 2.07-stable
  
• d5o9ac1 appears in the current release, SCOPe 2.08